People Search
Phones, Emails, Addresses, Background check, Web references
All public info
Like other search engines (Google or Bing) Radaris collects information from public sources.
duas cargas puntiformes fixas são colocadas a uma … ...
UMO combines innovative Asian technology with proven skin enhancing ingredients in the UMO Facial Spa for skin rejuvenation. The latest skincare advancements of Gamma PGA, Ions ...
>uma:um01272.1 hypothetical protein (a) msaelasikrqltiktgvvkrssrelcsvstvilistftvldgcgtamsrlakeessylv eakqqetriaqfidagrdeydvkqqrsvladtlkmipdcrkrlqlatdellnyvvslpts ...
Moby's new independently released album Wait For Me will be digitally distributed across Europe by Zebralution.
... 129 ta nsv895 951202.140 <138 ta per ax 951201.944 117 a tau hw 951202.154 <129 ta uma bz 951202.171 <137 a uma ch 951201.062 <127 a uma ...
auma electric actuators ... E-mail: support@auma-taiwan.com.tw: TEL: 886-2-2225-1718: FAX: 886-2-8228-1975
AUMA Actuators, Inc. has been manufacturing valve actuators for over 40 years and is a major supplier of electric actuators and manual operators to industry.
Multiturn electric actuators AUMA Singapore & Malaysia valves supplier, Supplies of control valves equipment,butterfly valves,flow control valves,electric actuator,ball ...
Linkedin