People Search
Phones, Emails, Addresses, Background check, Web references
All public info
Like other search engines (Google or Bing) Radaris collects information from public sources.
Wu, YP; Ong, CK; Lin, GQ; Li, ZW JOURNAL OF PHYSICS D-APPLIED PHYSICS, 39 (14): 2915-2919 JUL 21 2006 . 14. Fabrication of quasi-one-dimensional oxide nanoconstriction array via ...
Huang, GQ; Li, L; Lau, TL: 2007: Using genetic algorithms to solve quality-related bin packing problem: Chan, FTS; Au, GKC; Chan, PLY; Lau, TL: 2007: A genetic algorithm approach to machine ...
... gisl d sbjct: 146 ialisrgectfatksvlsakagaaaalvynniegsmagtlggatselgayapiagislad 205 query: 200 gqkliklaeagsvsvdlwvdskqenrttynvvaqtkggdpnnvvalgghtdsveagpgin 259 gq li ...
m.cc':2p0q7(#1'3\5tcg9t4`?<!9h:=i.yvte\/mg=gq?<li)*7i$kp>'q>^ mk<nti=1b,7bs#ibv:1w<7c0mb,ip,:n=ky+;/&(9f0f;teyyp4n[y#b`b)4e. m@9kutmyu?`zi=v;']q-z5@%4#50,-sn4z8\.(:aj0*wz[=t)(&(`&z)x!j
Database: Pfam Entry: TerB LinkDB: TerB Original site: TerB #=GF ID TerB #=GF AC PF05099.6 #=GF DE Tellurite resistance protein TerB #=GF AU Bateman A #=GF SE COG3793 ...
5/34 Function I Mathematical view: a function is a relation, where xRy^xRz! y=z I Logical/Rewriting view: confluence, describing that terms in this system can be rewritten in ...
Wu, YP; Ong, CK; Lin, GQ; Li, ZW JOURNAL OF PHYSICS D-APPLIED PHYSICS, 39 (14): 2915-2919 JUL 21 2006 . 14. Fabrication of quasi-one-dimensional oxide nanoconstriction array ...
Huang, GQ; Li, L; Lau, TL: 2007: Using genetic algorithms to solve quality-related bin packing problem: Chan, FTS; Au, GKC; Chan, PLY; Lau, TL: 2007: A genetic algorithm approach ...
Linkedin