People Search
Phones, Emails, Addresses, Background check, Web references
All public info
Like other search engines (Google or Bing) Radaris collects information from public sources.
SIMPLE = T / file does conform to FITS standard BITPIX = -32 / number of bits per data pixel ...
Database: Pfam Entry: DUF328 LinkDB: DUF328 Original site: DUF328 #=GF ID DUF328 #=GF AC PF03883.7 #=GF DE Protein of unknown function (DUF328) #=GF AU Bateman A ...
... 1558 aleeflksvretwqnysldlvnyqnkcrlirgfddlfakcsenlnslqamrhspy+kefe sbjct ... 3472 rvgplr+ev +lee a+ t+a aqa+e i le iatykaeya l+setqaik emsr sbjct ...
Linkedin