People Search
Phones, Emails, Addresses, Background check, Web references
All public info
Like other search engines (Google or Bing) Radaris collects information from public sources.
Livia Lv Hebei Armeiszhuang Mineral Wool Board Co., Ltd. Huaishu Town Economic Development Zone of Jinzhou City, Hebei, China P.C.:052260 Email:new1@hbamsz.com MSN ...
Address: Huaishu Town Economic Development Zone of Jinzhou City.Hebei.China ... 86-0311-84439066: Contact name: livia lv , saleswowen
... 86-311-8443-9066; Fax : 86-311-8443-9599; Homepage : http://www.hbamsz.com. Contact : Ms. livia lv saleswomen, sales
Louis Vuitton ... the E-mail&MSN: everest-trade@hotmail.com. Attn:Livia Cai. Tel:86-592-2966291
... Cooperation Department), the State Intellectual Property Office (2) Ms. LV Zhi Hua ... Director, Enforcement Department, the National Copyright Administration (4) Ms. Livia ...
... 6e-21 gb|AAB01787.1| (U43513) Y-Box binding protein [Columba livia] 101 6e-21 ref|NP ... 119 LVDGKNGPEAANVTGPAGVNVSGSKYRHQLLSRFRKNRKPKIVVGEDFDSKETEKLVEAP 178 LV ...
Linkedin