Icely Hu

All public info

Like other search engines (Google or Bing) Radaris collects information from public sources.

Radar Icely Hu
Information removal
Genealogical search

Social Media with Icely Hu

icely hu

Locality:: China
Summary:: valve sales at Kaitai Valve Group
Experience:: Kaitai Valve Group (Privately Held; Machinery industry): valve sales, (-)

Relative references Icely Hu

Web Results

Protein Kinase Catalytic Domain Database

; hu,e. and rubin,c.s. j biol chem 1990 mar 25;265(9):5072-80; accession j05274; eckii yqlvrklgrgkysevfegfkmstdekvvvkilkpvkkkkikreikilenlrggtniitlldvvkdpisrt

Newspapers - The Straits Times, 18 September 1972

NewspaperSG is an online resource of current and historic Singapore and Malaya newspapers. You can search our digital archive of English language newspapers published ...

hadiba.web.ugm.ac.id

hU[email protected] . jcluvsarah . [email protected] ... icely[email protected] . 5201101 . [email protected] . qwertyuiop

Icely Hu

Possible relatives

Social Media with Icely Hu

Linkedin

Relative references Icely Hu

Web Results