Livia Lv

All public info

Like other search engines (Google or Bing) Radaris collects information from public sources.

Radar Livia Lv
Information removal
Genealogical search

David Lv
Davis Lv
Doris Lv
Livia Johnson
Livia Stan
Livia Jones

Social Media with Livia Lv

Livia Lv

Locality:: China
Summary:: at Open Terrace Ltd.
Experience:: Open Terrace Ltd. (Computer Networking industry): Product Manager, (November 2009-Present) My experience at Open Terrace has been everything I thought that it would be, and more,

Relative references Livia Lv

Web Results

Hebei Armeiszhuang Mineral Wool Board Co.,Ltd.

Livia Lv Hebei Armeiszhuang Mineral Wool Board Co., Ltd. Huaishu Town Economic Development Zone of Jinzhou City, Hebei, China P.C.:052260 Email:[email protected] MSN ...

Hebei Armeiszhuang Mineral Wool Board Co.,Ltd - mineral wool board ...

Address: Huaishu Town Economic Development Zone of Jinzhou City.Hebei.China ... 86-0311-84439066: Contact name: livia lv , saleswowen

Hebei Armeiszhuang Mineral Wool Board Co., Ltd. - mineral wool ...

... 86-311-8443-9066; Fax : 86-311-8443-9599; Homepage : http://www.hbamsz.com. Contact : Ms. livia lv saleswomen, sales

nice crystal,pearl,white gold,sterling silver,TIFFANY, GUCCI ...

Louis Vuitton ... the E-mail&MSN: [email protected]. Attn:Livia Cai. Tel:86-592-2966291

Mainland, Hong Kong SAR and Macao SAR Intellectual Property ...

... Cooperation Department), the State Intellectual Property Office (2) Ms. LV Zhi Hua ... Director, Enforcement Department, the National Copyright Administration (4) Ms. Livia ...

BLAST Search Results

... 6e-21 gb|AAB01787.1| (U43513) Y-Box binding protein [Columba livia] 101 6e-21 ref|NP ... 119 LVDGKNGPEAANVTGPAGVNVSGSKYRHQLLSRFRKNRKPKIVVGEDFDSKETEKLVEAP 178 LV ...

Livia Lv

Possible relatives

Social Media with Livia Lv

Linkedin

Relative references Livia Lv

Web Results

We value your privacy