People Search
Phones, Emails, Addresses, Background check, Web references
All public info
Like other search engines (Google or Bing) Radaris collects information from public sources.
... can efficiently capture a wide range of microorganisms including the hard-to-lyse Gram ... synthase (PKS) gene targeting the ketosyntase alpha (KS ) domain (540F : 5'- GG(I ...
... 7 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = -3 Query: 344 ALLKSMGDGKHSPSGGPYARLPTRAIKKIKKKPCLFLQFI*LYSE*QNSSNSTYFRV 174 A++K++ DG+ +P+GG Y ...
... previous operations, severe bowel adhesion was noted, and it was difficult to lyse the ... Haddad GG, Mazza NM, Defendini R, Blanc WA, Driscoll JM, Epstein MA, Epstein RA, et ...
Linkedin